PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA12591
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family MYB
Protein Properties Length: 535aa    MW: 59824.8 Da    PI: 4.6543
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA12591genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-16137184148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                +g WT  Ede+lv+ vk++G g+W+++ ++ g+ R++k+c++rw ++l
  Tp57577_TGAC_v2_mRNA12591 137 KGTWTSAEDEILVEHVKKYGLGNWNAVQKYSGLARCGKSCRLRWANHL 184
                                799*****************************************9986 PP

2Myb_DNA-binding43.29.2e-14190233146
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                +g +T eE ++ ++++  +G++ W++ a+ m+ gRt++++k++w++
  Tp57577_TGAC_v2_mRNA12591 190 KGEFTDEEKKKVLELHFSMGNK-WARMAALMP-GRTDNEIKNYWNT 233
                                799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.938132188IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-22134187IPR009057Homeodomain-like
SuperFamilySSF466891.43E-28135231IPR009057Homeodomain-like
SMARTSM007171.5E-13136186IPR001005SANT/Myb domain
CDDcd001673.07E-11139184No hitNo description
PfamPF139211.1E-14140201No hitNo description
Gene3DG3DSA:1.10.10.606.5E-22188237IPR009057Homeodomain-like
SMARTSM007174.2E-13189237IPR001005SANT/Myb domain
PROSITE profilePS5129415.413189239IPR017930Myb domain
CDDcd001671.70E-9192233No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MSTTSGGDDG RKALKGKKMM SLSSGDDSQM LKHNRPSSSS GDVDCKRIKR SESALLGEED  60
DQGRNVEGEG ILRGMTSTSS VDNGHKKIKR SWSSSSSLDD DCKRIKPSQS LLSGEEDDDE  120
DDQGGDSGEG EEGSLKKGTW TSAEDEILVE HVKKYGLGNW NAVQKYSGLA RCGKSCRLRW  180
ANHLRPELKK GEFTDEEKKK VLELHFSMGN KWARMAALMP GRTDNEIKNY WNTRAKRLRR  240
VGLPLYPEEI SKNPLKADPE NGDANEASQC DESENYNIPV VEFEDYKFHP GMIPPCFDIT  300
TLIERPSKRP LESNMIYSDL GGCSSSAAVQ EVFDPYGKYP MLAPPCDPSF YTDAQFHGYD  360
NILDGIHTVP NVSSSEPLYG SMRYELPSLQ YLQTQQGSWS VSPLTSLESI DTMIHSSPNE  420
PYQSSPNELY QSDPTSPDSN HFLDTILHSN DDSFQEKIEN TVPNEADNST QWNILDDQSG  480
ASFLPSDYNA HHINMWSIDR SHLVETTQDH GNLDQIDFAR PDAMLESDWR MKNK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-291352375106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003543825.21e-116PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_006593626.11e-117PREDICTED: transcription factor GAMYB-like isoform X2
RefseqXP_006593627.11e-117PREDICTED: transcription factor GAMYB-like isoform X2
RefseqXP_014620817.11e-117PREDICTED: transcription factor GAMYB-like isoform X2
TrEMBLA0A0R0GJT21e-116A0A0R0GJT2_SOYBN; Uncharacterized protein
TrEMBLK7LXA11e-117K7LXA1_SOYBN; Uncharacterized protein
STRINGGLYMA13G04031.11e-116(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.36e-66myb domain protein 33